PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 47266
Common NameSELMODRAFT_47266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family NAC
Protein Properties Length: 223aa    MW: 25102.6 Da    PI: 9.6459
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
47266genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.4e-5491341128
    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkk 104
            lppGfrFhPtdeelvv+yL+++++++++ +  +i+evd+yk++PwdLp k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++ s +g +vg+kk
  47266   9 LPPGFRFHPTDEELVVHYLARRAASRPFAV-PIIAEVDLYKFDPWDLPDKALFGEREWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKPISS-DGCKVGVKK 110
            79*************************999.88***************8777899**************************************9.999****** PP

    NAM 105 tLvfykgrapkgektdWvmheyrl 128
             Lvfy+grapkg+kt+W+mheyrl
  47266 111 ALVFYRGRAPKGSKTSWIMHEYRL 134
            **********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.19E-674165IPR003441NAC domain
PROSITE profilePS5100561.8719165IPR003441NAC domain
PfamPF023659.4E-2810134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
KKAVNSLQLP PGFRFHPTDE ELVVHYLARR AASRPFAVPI IAEVDLYKFD PWDLPDKALF  60
GEREWYFFSP RDRKYPNGAR PNRAAGSGYW KATGTDKPIS SDGCKVGVKK ALVFYRGRAP  120
KGSKTSWIMH EYRLADASGA SNRLSLRKKG SLRLDDWVLC RIYKKQSSDW KSPAASQEAP  180
SRENVKMDAD DESCLEEVLA SLPDIDDSKI CLPRLGSFTA MLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-86416815171NAC domain-containing protein 19
3swp_C3e-86416815171NAC domain-containing protein 19
3swp_B3e-86416815171NAC domain-containing protein 19
3swp_A3e-86416815171NAC domain-containing protein 19
3swm_D3e-86416815171NAC domain-containing protein 19
3swm_C3e-86416815171NAC domain-containing protein 19
3swm_B3e-86416815171NAC domain-containing protein 19
3swm_A3e-86416815171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00012PBMTransfer from AT1G52890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002991033.11e-164hypothetical protein SELMODRAFT_47266, partial
SwissprotQ93VY36e-90NAC72_ARATH; NAC domain-containing protein 72
TrEMBLD8T6391e-164D8T639_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ078411e-163(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.22e-87NAC family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]